PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_05295.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ARF
Protein Properties Length: 747aa    MW: 81183.6 Da    PI: 8.1905
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_05295.1_g00002.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.72.5e-24159260199
                              EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-E CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDf 79 
                              f+k+lt sd++++g +++p++ ae++       +  ++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD 
  Sme2.5_05295.1_g00002.1 159 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyrQ--QRPSQELVAKDLHGIEWKFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDA 242
                              99****************************9743..345679******************************************** PP

                              EEEEE-SSSEE..EEEEE-S CS
                       B3  80 vvFkldgrsefelvvkvfrk 99 
                              v+F +  + ++el+++v+r+
  Sme2.5_05295.1_g00002.1 243 VLFLR--TGDGELRLGVRRA 260
                              ****4..4788899999986 PP

2Auxin_resp118.17.3e-39285366182
               Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                              a +a+s++++F+++YnPr s+s+F+v+++k++k+l +++s+GmRfkm++eted++e+r++G+vvgvsd+dpvrWp+SkWr+L
  Sme2.5_05295.1_g00002.1 285 AFNAISSRNTFNICYNPRGSSSDFIVPYHKFSKTLAHPFSAGMRFKMRVETEDAAEQRFTGLVVGVSDVDPVRWPGSKWRCL 366
                              6799*****************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.109.6E-41152268IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.89E-42153264IPR015300DNA-binding pseudobarrel domain
CDDcd100175.45E-22157259No hitNo description
PROSITE profilePS5086313.507159261IPR003340B3 DNA binding domain
PfamPF023623.4E-22159260IPR003340B3 DNA binding domain
SMARTSM010196.7E-23159261IPR003340B3 DNA binding domain
PfamPF065071.3E-33285366IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0010582Biological Processfloral meristem determinacy
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 747 aa     Download sequence    Send to blast
MMCGLIDLNT VDNDDVGEET TTPVSLDSPA TSSAASGSSD LTSSTTPAVA SVCMELWHAC  60
AGPLISLPKK GSAVVYLPQG HLEHISEYPP ISFNLPPHVF CRVVDVKLQA DAATDEVCAQ  120
VSLVPDNQIE QKWRDGDVDA DTEEEEIEGA GKSSTPHMFC KTLTASDTST HGGFSVPRRA  180
AEDCFPPLDY RQQRPSQELV AKDLHGIEWK FRHIYRGQPR RHLLTTGWSA FVNKKKLVSG  240
DAVLFLRTGD GELRLGVRRA AQAKSCSSYL APHSKLLNVG GIVDAFNAIS SRNTFNICYN  300
PRGSSSDFIV PYHKFSKTLA HPFSAGMRFK MRVETEDAAE QRFTGLVVGV SDVDPVRWPG  360
SKWRCLLVRW DDLDVSRHNR VSPWEVEPSG SAPVSSSLVM PSAKRTRVGF PISKADFPIR  420
RDGIAVSDFG ESSRFQKVLQ GQEILGMHAP CGGLDARSPR PAGIRCFPGF PSSGISRMGN  480
SVRPVLGDND KSHESVGFSG SLRFNKVLQG QEIFRSPPCG RAQAGFHMQE KSRTGTFVGI  540
QVPNHGNRWP APNQDLRTFC KPSNPVPASS PPSALTFPNP SPPASQFHAM FNHKRGKLEP  600
GNRASLDMSE NCCRYLASGS HTEDISRKEG AQGISSFGFL KEQKQTGTSY LSLGTQSSFK  660
GNQNLVSTCK TSCRIFGFSL TESKISTTSV ETPSKAVYSH GLETTFLPSG DGKLQPGPPL  720
MSTVVGTNFT KVNDLYAARD VLLDIAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1095139118357Auxin response factor 1
4ldw_A1e-1095139118357Auxin response factor 1
4ldw_B1e-1095139118357Auxin response factor 1
4ldx_A1e-1095139118357Auxin response factor 1
4ldx_B1e-1095139118357Auxin response factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00021PBMTransfer from AT2G33860Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ3402540.0DQ340254.1 Lycopersicon esculentum auxin response factor 3 (ARF3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006364315.10.0PREDICTED: auxin response factor 3-like isoform X2
SwissprotO236610.0ARFC_ARATH; Auxin response factor 3
TrEMBLM1D4H80.0M1D4H8_SOLTU; Auxin response factor
STRINGPGSC0003DMT4000812820.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61012333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.10.0ARF family protein